PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10028858m
Common NameCICLE_v10028858mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family B3
Protein Properties Length: 317aa    MW: 37101.6 Da    PI: 9.1946
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10028858mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.14.4e-1532119397
                      EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      k+   + vl+++ l++p++f++++g++   s   +l+ ++g +W+v l  ++k++ +++  GW++Fv++  + +g f+ F+++++s+f  ++ +
  Ciclev10028858m  32 KII-FPFVLAEKKLRIPRDFVKKFGHE--LSNGAQLTVPDGSVWQVAL--TRKGKDIWFHYGWEDFVESYSISAGYFLFFSYEKNSTF--HIII 118
                      544.355777788***********966..777899*************..9*******************************999988..6666 PP

                      E CS
               B3  97 f 97 
                      f
  Ciclev10028858m 119 F 119
                      5 PP

2B337.93.1e-122313081494
                      T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      + ++ p kfa+++ +k  + +++++ +e  +s e++    k +g+++lt+GW +  + ++LkegD+++F+l+++++  +++
  Ciclev10028858m 231 RDVYCPIKFAAKFVKKDSKYVKVQISNEVKESIELQW---KPKGGFFLTRGWAKISRVKNLKEGDICIFELIRKQDLLFKL 308
                      4467899999999766667778888888888888887...5556899************************9977664555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.55E-2225124IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.6E-2227124IPR015300DNA-binding pseudobarrel domain
CDDcd100172.21E-1528120No hitNo description
PROSITE profilePS5086312.91529122IPR003340B3 DNA binding domain
SMARTSM010196.1E-1430122IPR003340B3 DNA binding domain
PfamPF023622.5E-1232118IPR003340B3 DNA binding domain
SuperFamilySSF1019367.65E-15212311IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-13212311IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.037218314IPR003340B3 DNA binding domain
SMARTSM010190.0025219314IPR003340B3 DNA binding domain
PfamPF023622.4E-10225307IPR003340B3 DNA binding domain
CDDcd100175.76E-8236311No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MTERAAATWL FEQQWRKRLN PGADVSSPHF FKIIFPFVLA EKKLRIPRDF VKKFGHELSN  60
GAQLTVPDGS VWQVALTRKG KDIWFHYGWE DFVESYSISA GYFLFFSYEK NSTFHIIIFN  120
LDACEVDYLY VGEESMKDEQ NSDPENEKSV EHVEQQSRKR KMEEVAEMDE PNSDNNFNLS  180
VVLKKMGIYV TPRYRRFSAE ESKRAISFAR IVQPKNSSFM VILEQHFKSC RDVYCPIKFA  240
AKFVKKDSKY VKVQISNEVK ESIELQWKPK GGFFLTRGWA KISRVKNLKE GDICIFELIR  300
KQDLLFKLSV FHSMLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A3e-1519031220141B3 domain-containing transcription factor VRN
4i1k_B3e-1519031220141B3 domain-containing transcription factor VRN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1156161SRKRKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006423710.10.0hypothetical protein CICLE_v10028858mg
TrEMBLV4SDP10.0V4SDP1_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15912578
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.18e-49B3 family protein